PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000246.1_g00026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 128aa    MW: 13953.5 Da    PI: 4.9789
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000246.1_g00026.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC24.36.8e-081893983
                    NF-YC  9 qiekatdfknhelPlarikkilkad.edvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaav 83
                             q e+++    ++lP+a + +i+k+  +d   i+aea  l+      fi  +t  +  + +  kr+tl   d+ +++
  Itr_sc000246.1_g00026.1 18 QSENHNPEYVRSLPIANVVRIMKKAlPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSL 93
                             556666666789**********85449**************99999**********************99998765 PP

2NF-YB127.45.2e-4028116694
                    NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                              r lPianv+rimkk+lP +a i+ +ak +v+ec++efisf+tseas++ q ekrkt++gdd+l +l tlGf +yvepl++yl+ky+
  Itr_sc000246.1_g00026.1  28 RSLPIANVVRIMKKALPDDANITAEAKLLVEECATEFISFITSEASERGQIEKRKTLTGDDVLNSLNTLGFGNYVEPLRTYLMKYK 113
                              89************************************************************************************ PP

                    NF-YB  92 ele 94 
                              e +
  Itr_sc000246.1_g00026.1 114 END 116
                              965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.6E-4118124IPR009072Histone-fold
SuperFamilySSF471134.84E-3228125IPR009072Histone-fold
PfamPF008081.0E-212990IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-145775No hitNo description
PRINTSPR006152.4E-147694No hitNo description
PRINTSPR006152.4E-1495113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEGAPGGGGG GGSHQSSQSE NHNPEYVRSL PIANVVRIMK KALPDDANIT AEAKLLVEEC  60
ATEFISFITS EASERGQIEK RKTLTGDDVL NSLNTLGFGN YVEPLRTYLM KYKENDFKEE  120
NKGSNSRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-3428114692Transcription factor HapC (Eurofung)
4g92_B3e-3428114692Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295779.11e-38nuclear transcription factor Y subunit B-1
RefseqXP_008442638.11e-38PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2
RefseqXP_011651935.11e-38PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2
SwissprotQ8VYK42e-37NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0D3B5C31e-38A0A0D3B5C3_BRAOL; Uncharacterized protein (Fragment)
TrEMBLS6DEZ21e-38S6DEZ2_CUCSA; Nuclear transcription factor Y subunit B-8-like
STRINGVIT_13s0019g03600.t016e-37(Vitis vinifera)
STRINGBra023095.1-P9e-37(Brassica rapa)
STRINGGLYMA19G36220.21e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.72e-37nuclear factor Y, subunit B1